Protein Info for HSERO_RS21280 in Herbaspirillum seropedicae SmR1

Annotation: allantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03212: putative urate catabolism protein
  • amino acids 7 to 307 (301 residues), 541 bits, E=3.1e-167
• PF01522: Polysacc_deac_1
  • amino acids 76 to 163 (88 residues), 39.8 bits, E=2.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4258)

Predicted SEED Role

"Uricase (urate oxidase) (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

• ureide biosynthesis (5/7 steps found)
• urate conversion to allantoin I (2/3 steps found)
• superpathway of purines degradation in plants (9/18 steps found)

KEGG Metabolic Maps

• Caffeine metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

See D8IUJ5 at UniProt or InterPro

Protein Sequence (310 amino acids)

>HSERO_RS21280 allantoinase (Herbaspirillum seropedicae SmR1)
MSQQQSYPRDLAGYGRNPPHARWPGQARVALQFVLNYEEGGENCVLHGDAASEQFLSEIV
GAAAYPARHMSMESIYEYGSRVGVWRILREFEKRGLPLTVFGVAMALQRSPEVTQAFVEL
GHEIACHGLRWIHYQSMDIETERAHMREAVQIFRELTGSAPLGWYTGRDSPNTRQLVVEH
GGFVYDSDYYGDDLPFWTEVETAAGVKAPHLVVPYTLDSNDMRFATPQGFNTSEHFFQYL
KDSFDVLYEEGEEAPKMLSIGMHCRLLGRPGRFRALQRFLDYVQSHDKVWICRRIDIAEH
WRKVHPYSER