Protein Info for HSERO_RS21110 in Herbaspirillum seropedicae SmR1

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 293 to 465 (173 residues), 45.2 bits, see alignment E=1.7e-15 PF02719: Polysacc_synt_2" amino acids 293 to 584 (292 residues), 414.7 bits, see alignment E=4.8e-128 PF01370: Epimerase" amino acids 293 to 494 (202 residues), 75.3 bits, see alignment E=1.3e-24 PF01073: 3Beta_HSD" amino acids 294 to 424 (131 residues), 23.1 bits, see alignment E=9e-09 PF16363: GDP_Man_Dehyd" amino acids 294 to 419 (126 residues), 53.7 bits, see alignment E=6.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4222)

Predicted SEED Role

"Nucleoside-diphosphate sugar epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUF9 at UniProt or InterPro

Protein Sequence (648 amino acids)

>HSERO_RS21110 dTDP-glucose 4,6-dehydratase (Herbaspirillum seropedicae SmR1)
MKQPLFKLAIPILALPRATKRLVAVSVDMGLCVLTVWLAYYLRLGEFVALSGTALWAAGA
SVMLALPIFIVSGLYRAIFRYSGWPALLAVARAVGIYGLLYASIFTSISVPGVPRTVGII
QPILLLLFVGASRALARVWLGDQYLSILKQASRPKVLIYGAGSTGRQLVAAMASSHEMQV
VGFLDDDDRLHGHVLNGQPIYNPADLSSLASTLSISNVLLAMPSLSRKRRNEILAQIRTA
RVAVRTLPSVTDLAQGRVNVSDLRELDIDDLLGREPVMPNHILLAMNVRSKVVMVTGAGG
SIGSELCRQILAVGPSKLLLIEQSEFALYAIHQQLEEKLADRDIVLVPLLASVQDSERIR
EIMSTWHPDTVYHAAAYKHVPLVEHNPAEGIKNNVLGTLRTAQAATENGVADFVLISTDK
AVRPTNIMGASKRLAEMVLQAIAATSPGTKFSMVRFGNVLGSSGSVVPKFRQQIRDGGPI
TLTHADITRYFMTIPEASQLVIQAGAMAKGGDVFVLDMGQAVRIMDLARRMIELSGLTVK
DELNPEGDIAIEITGLRPGEKLYEELLIGDNPKPTSHSRIMKAHEEFIPWAELEARLSAL
EMALNVNDVGVIRLMMEKLVTGYTPSDEIVDWVYLEQEAEAQALGLAS