Protein Info for HSERO_RS20945 in Herbaspirillum seropedicae SmR1

Annotation: RNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 PF09371: Tex_N" amino acids 4 to 77 (74 residues), 101.7 bits, see alignment E=5.6e-33 PF22706: Tex_central_region" amino acids 132 to 321 (190 residues), 247.9 bits, see alignment E=2.6e-77 PF16921: Tex_YqgF" amino acids 338 to 463 (126 residues), 178.1 bits, see alignment E=3.9e-56 PF12836: HHH_3" amino acids 503 to 567 (65 residues), 93.5 bits, see alignment E=2.7e-30 PF17674: HHH_9" amino acids 573 to 642 (70 residues), 90.9 bits, see alignment E=3e-29 PF23459: S1_RRP5" amino acids 660 to 726 (67 residues), 31 bits, see alignment E=1.2e-10 PF00575: S1" amino acids 661 to 732 (72 residues), 78.6 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to hse:Hsero_4187)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITM7 at UniProt or InterPro

Protein Sequence (783 amino acids)

>HSERO_RS20945 RNA-binding protein (Herbaspirillum seropedicae SmR1)
MLPSIEQRLALELAAKPVQVAAAIALLDEGATVPFIARYRKEVTGGLDDVQLRLLEERLR
YLRELESRRAAIIASIEEQGKMTPVLLDAITHAEDKTRLEDLYLPYKPKRRTKAQIAAEA
GLTELADALLNDPTLNPEEEAAKFIKPAFTTDNGDNPGVPDTKAALDGARQILMERFSED
AELLQSLREYLTEHGVVESKVIEGKQDAGEKFADYFDYSETYSTIPSHRALALFRGRREE
MLNVILRLDSEEEKPKWDAPHNPCEGRIASRFGVSNKGRAADKWLSDTVRWAWRVKVFMH
LETELMTNLREKAEAEAINVFARNLKDLLLAAPAGPRATMGLDPGLRTGVKVAIVDATGK
VVATDTIYPHQPRNDWNGSLHTLSQLAEKHNVSLISIGNGTASRETDKLAQDLIKLRPEL
KLTKIVVSEAGASVYSASEFASKELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVG
QYQHDVSQSQLARSLDAVVEDCVNAVGVDVNTASAPLLARVSGLNASVAQSIVSYRDMKG
MFSSRAALREVPRLGEKTFEQAAGFLRVMNGENPLDASAVHPESYPLVEKILADIKKDVK
SVLGQTSLLKGLSPAKYADEKFGVPTVTDILKELDKPGRDPRPEFTTATFKEGVEEIKDL
RPDMILEGVVTNVAAFGAFVDIGVHQDGLVHISALSNTYVKDPHTVVKAGQVVKVKVLEV
DEKRKRIALTMRLNDTAPAPGARNEQRGDRTDSRRLSQHQNQRGREQAPANNAMAAAFAK
LRG