Protein Info for HSERO_RS20925 in Herbaspirillum seropedicae SmR1

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR01353: putative dGTPase" amino acids 32 to 165 (134 residues), 190.6 bits, see alignment E=3.2e-60 PF01966: HD" amino acids 69 to 198 (130 residues), 52.5 bits, see alignment E=5.9e-18 PF13286: HD_assoc" amino acids 285 to 378 (94 residues), 104.3 bits, see alignment E=4.2e-34

Best Hits

Swiss-Prot: 71% identical to DGTL1_RALSO: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (RSc2968) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to hse:Hsero_4185)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITM5 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HSERO_RS20925 deoxyguanosinetriphosphate triphosphohydrolase (Herbaspirillum seropedicae SmR1)
MHTEAPDHLAPYAAHSASSRGRRFSETPPGSRSEFQRDRDRIVHSTAFRRLEYKTQVFVN
HEGDLFRTRLTHSIEVAQIARSCARNLQLNEDLVEAISLAHDLGHTPFGHAGQDELNHCM
KHHGGFEHNLQSLRVVDELEQHYGAFDGLNLSFETREGILKHCSLHNARQLGEIGLRFLE
KKQPSLEAQLANLADEIAYNNHDIDDGLRSGLLTMELMSEVDFFARHLREVEQAYPGITG
RRVIHETVRRMINALIVDLIQTSRSRIAEIAPRDIEDVRNAPQLIAFSDPMAAEAAVLKK
FLREKLYRHYQVNRMTAKARRIIAEMFEAFVGQPNLLPPDYQVHGIVDDALRSDKQARKV
ADYIAGMTDRYAIREHRRLFVME