Protein Info for HSERO_RS20850 in Herbaspirillum seropedicae SmR1

Annotation: ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02199: bifunctional protein RfaE, domain II
  • amino acids 15 to 157 (143 residues), 189.7 bits, E=2.4e-60
• TIGR00125: cytidyltransferase-like domain
  • amino acids 25 to 89 (65 residues), 47.8 bits, E=1.3e-16
• PF01467: CTP_transf_like
  • amino acids 27 to 123 (97 residues), 63 bits, E=1.7e-21

Best Hits

Swiss-Prot: 58% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4171)

MetaCyc: 47% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.- or 2.7.7.39

Sequence Analysis Tools

See D8ITL1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>HSERO_RS20850 ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase (Herbaspirillum seropedicae SmR1)
MADFESKLCTRDELQQRVAQLPKPVVMTNGVFDILHRGHVTYLAQARAQGAALVVAVNTD
ASVKRLGKGDDRPINTCDDRMAVLAALESVALVVPFDEDTALEAVQQARPEIYVKGGDYD
MHAIPEGQAVAAYGGQVLSIAFEHDRSTTKLLAKVRKLAG