Protein Info for HSERO_RS20790 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome B559 subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 55 to 78 (24 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details PF02790: COX2_TM" amino acids 35 to 116 (82 residues), 51.3 bits, see alignment E=2.1e-17 TIGR02866: cytochrome c oxidase, subunit II" amino acids 44 to 267 (224 residues), 197.9 bits, see alignment E=6.6e-63 PF00116: COX2" amino acids 131 to 258 (128 residues), 126 bits, see alignment E=1.5e-40 PF13442: Cytochrome_CBB3" amino acids 292 to 362 (71 residues), 53.4 bits, see alignment E=5.2e-18 PF00034: Cytochrom_C" amino acids 292 to 366 (75 residues), 36.6 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to hse:Hsero_4161)

MetaCyc: 51% identical to cytochrome c oxidase subunit 2 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITK1 at UniProt or InterPro

Protein Sequence (386 amino acids)

>HSERO_RS20790 cytochrome B559 subunit alpha (Herbaspirillum seropedicae SmR1)
MKLAKRLQSLILGASLLAAGLPAWAVVDSPGGPAVLQMNFQPPVTKIAEQIYDLHILMLI
ICLVIFVAVFGVMFYSIIKHRKSVGHKASTFHESTAVEIAWTVVPFLIVIGMALPATKTV
VAMKDTSNADLTIKVTGMQWKWGYDYLKGEGEGISFLSNLATPREQVTDPSLKKNDNYLI
EVDNPVVVPVNKKVRIVTTANDVIHSWTIPAFGVKQDAIPGFVRDTWFRAEKIGTYRGQC
VELCGKDHAFMPIVVNVVSEDDYKQWVDGKKKEMAAKADDPNKTWTVDELKQRGEKVYAA
NCVTCHQANGKGVPGAFPALDGSPVVNGPKDGQIHLVLNGKNAMPPWKGVLNDTEIAAVI
TYTRNSWSNKAQENIVQPAEVLAARK