Protein Info for HSERO_RS20725 in Herbaspirillum seropedicae SmR1

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 272 to 274 (3 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF18075: FtsX_ECD" amino acids 61 to 161 (101 residues), 56.4 bits, see alignment E=3.7e-19 PF02687: FtsX" amino acids 184 to 303 (120 residues), 48.5 bits, see alignment E=8.1e-17

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to hse:Hsero_4148)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ITI8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HSERO_RS20725 permease (Herbaspirillum seropedicae SmR1)
MNWLRQHFAAIGDALRHLLRSPGNFLLNVLVVSIALALPFAGLSALENVRPISDQMSVEP
EISIFMKPDASREAAQALGKTISQVLKDSNTVGKVEFIPREKAFDALKSKTGLADVLNTL
GSNPLPDSYVLRLPGFQNAMDAGRVDQIAQQLQKQAGVDTVQIDSEWVKRLAALLRILRL
VLLFLGITLGAVVVAVVFNTIRLQVMTQRDEIEVSRLFGATNSFIYRPFYYTGALLGVCA
GLVALGLVVAAQQPLNAAILDFAHLYASEFQLALPSPMAIGLLLAVSALLGLFGAMLSVR
RQMARGA