Protein Info for HSERO_RS20615 in Herbaspirillum seropedicae SmR1

Annotation: phenylacetate-CoA oxygenase subunit PaaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06243: PaaB
  • amino acids 4 to 90 (87 residues), 138.6 bits, E=3.3e-45
• TIGR02157: phenylacetate-CoA oxygenase, PaaH subunit
  • amino acids 5 to 92 (88 residues), 130.3 bits, E=1.1e-42

Best Hits

Swiss-Prot: 57% identical to PAAB_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit B (paaB) from Escherichia coli (strain K12)

KEGG orthology group: K02610, phenylacetic acid degradation protein (inferred from 100% identity to hse:Hsero_4126)

MetaCyc: 62% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaB subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaH subunit"

MetaCyc Pathways

• superpathway of phenylethylamine degradation (11/11 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

See D8ITG6 at UniProt or InterPro

Protein Sequence (94 amino acids)

>HSERO_RS20615 phenylacetate-CoA oxygenase subunit PaaB (Herbaspirillum seropedicae SmR1)
MSKEWPLWEVFIRSQHGLAHKHVGSLHAPDGEMAINNARDVYTRRNEGVGIWVVRAADIV
SSSPGDKAPLFEPSNSKVYRHPTFFPMPAELKNL