Protein Info for HSERO_RS20140 in Herbaspirillum seropedicae SmR1

Annotation: cell envelope biogenesis protein OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04972: BON" amino acids 38 to 77 (40 residues), 20.7 bits, see alignment 4.3e-08 PF00691: OmpA" amino acids 165 to 259 (95 residues), 74.9 bits, see alignment E=5.6e-25

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB K03286, OmpA-OmpF porin, OOP family (inferred from 100% identity to hse:Hsero_4029)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IST4 at UniProt or InterPro

Protein Sequence (267 amino acids)

>HSERO_RS20140 cell envelope biogenesis protein OmpA (Herbaspirillum seropedicae SmR1)
LKTNILSLFYRLALSAVCLSCTTSDAQNLAPPVATPAPGQVLVTGTVPDEASKAAALTRL
RELYGHDRVVDQISVGPVVLPANWNNHVQKLISPNLKAVRQGQLKIDGTNVSISGEVSHE
AQRQQIASDMATSLNSSYIINNGLRVSTSEQGVLDNTLANRVVSFESGRATLTPEGKRIL
DEIAATMLQLKGRRVEIIGNTDNEGLRASNISLSLARADAVKAYLSTKGVDDSLLTTSGQ
GPDRPVASNATSEGRARNRRIEFRIAK