Protein Info for HSERO_RS20100 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 56 (24 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 308 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 302 (263 residues), 63.4 bits, see alignment E=9.9e-22

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_4022)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISS7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>HSERO_RS20100 ABC transporter permease (Herbaspirillum seropedicae SmR1)
VLSRHEIQTLLLPMATLAVVLAPIFWINPNTMSYFGLGLLLNLAVPMILASMAQLCIIAV
NDLDLSIGAFISLVSCIAVTWLPERPVLGVAALVACVLLYAAIGALVELFDLPSIVVTLG
LSFVWGGFVWGGWALILLPMPGGATPQWIQDVMNLAIPVIPTPIVYAVLIALCAHWFLMR
SSTGVRLRGAGGNPKAIVRSGGSVVRAKALMYGLAGVLGILSALTLVGITTSADANIAQR
YTLISIAAVILGGGSFIGGKVSPIGATLGAITLGIAASFLSFLNIAPKWQIGLQGAILII
VLSMRILLSARGERQ