Protein Info for HSERO_RS20095 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 295 to 311 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 305 (261 residues), 65.2 bits, see alignment E=2.8e-22

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_4021)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISS6 at UniProt or InterPro

Protein Sequence (316 amino acids)

>HSERO_RS20095 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSRLRSTLEQRPWVWSFLGAALLWLATLAVAGPDAAVNIGLSAFSFGALMVLVGLGQMLV
VTTGPGNIDLSIPSTIALAGALGLRTMGGEDGGILLGLVVTLGVGVGIGLANYLLIRLLQ
IPPIIATMSSSFILQSLAIHVGQGLKITPPQLLASFATGWLLHVPQLAWLVLAVALGLAW
ILGRTLFGRFLSAVGQNARAAWLAGIGVERIRCLCYVLCAVFAALCALLIAGFSGGASLD
MGNEYLLMSVAVVVIGGTSVTGGRPSVAGIWGAALFLYFTNTLLNVVGLSAGERSVLSGL
IIIAVIVCSGRRRQYR