Protein Info for HSERO_RS20040 in Herbaspirillum seropedicae SmR1

Annotation: 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 11 to 136 (126 residues), 73.7 bits, E=1.8e-24
• PF03061: 4HBT
  • amino acids 20 to 106 (87 residues), 36.9 bits, E=3.7e-13

Best Hits

Swiss-Prot: 48% identical to 4HBT_PSEUC: 4-hydroxybenzoyl-CoA thioesterase from Pseudomonas sp. (strain CBS-3)

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 100% identity to hse:Hsero_4010)

MetaCyc: 48% identical to 4-hydroxybenzoyl-CoA thioesterase monomer (Pseudomonas sp. CBS3)
4-hydroxybenzoyl-CoA thioesterase. [EC: 3.1.2.23]

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (5/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.23

Sequence Analysis Tools

See D8ISR5 at UniProt or InterPro

Protein Sequence (139 amino acids)

>HSERO_RS20040 4-hydroxybenzoyl-CoA thioesterase (Herbaspirillum seropedicae SmR1)
MSKTIIHPVRVEFGDCDPAGIVYFPNFFRWYDAASRNFFHECGVPPWRDTEKTRGIIGTP
VVDISSRFVRPATYGDRIEVHSSIVEWNDKTFVMQHEIKRDGELLCEGRDVRVFAIRHPD
DPARIKAIPIPADIREMCS