Protein Info for HSERO_RS19920 in Herbaspirillum seropedicae SmR1

Annotation: protocatechuate 3,4-dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12391: PCDO_beta_N
  • amino acids 8 to 33 (26 residues), 37.6 bits, see alignment (E = 1.4e-13)
• TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit
  • amino acids 12 to 228 (217 residues), 327.1 bits, E=2.7e-102
• PF00775: Dioxygenase_C
  • amino acids 53 to 222 (170 residues), 179.9 bits, E=3.4e-57

Best Hits

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 100% identity to hse:Hsero_3986)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• 4-sulfocatechol degradation (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

See D8ISP1 at UniProt or InterPro

Protein Sequence (230 amino acids)

>HSERO_RS19920 protocatechuate 3,4-dioxygenase subunit beta (Herbaspirillum seropedicae SmR1)
MQFDAIEPGVYPELIYPPYKSTVKRGPTQAPLRVRDEIATGTNLFASPKLILPHDMDLTK
QGKGEPLGEKIVVTGRVVDEDGKPVRNSLLEVWQCNAAGRYFHKKDQHDAPLDPNFTGFG
KMLTDDNGRYRFVSIKPGPYPWGNHHKAWRPAHIHFSLFGNVYAQRLVTQMYFPNDPLFA
YDPIFQSIPDEAARQRLISRFSLEETVDDKMLGYEFDIVLRGRNATPMGI