Protein Info for HSERO_RS19455 in Herbaspirillum seropedicae SmR1

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 18 to 206 (189 residues), 183 bits, E=7e-58
• PF08659: KR
  • amino acids 21 to 129 (109 residues), 40.5 bits, E=4.2e-14
• PF13561: adh_short_C2
  • amino acids 27 to 256 (230 residues), 205.3 bits, E=1.7e-64

Best Hits

Swiss-Prot: 50% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to hse:Hsero_3897)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See D8IS27 at UniProt or InterPro

Protein Sequence (257 amino acids)

>HSERO_RS19455 3-ketoacyl-ACP reductase (Herbaspirillum seropedicae SmR1)
MSKQDQQAAVSTSTLVSKVAFVQGGSRGIGAAIVQRLAAEGATVAFTYVSSPDKAQALVS
SVQAKGGRALAIQADSADAAALQQAIRLAAETFGRLDILVNNAGVLAMGPLDQFKLEDLD
RTLAVNVRSVFVATQEAARYMGEGGRVISIGSTNADRIPFAGGAVYAMSKSALVGLTKGL
ARDLGPRGITVNNVQPGPVDTDMNPASGDFAASLTGLMALPRYGKAEEIASFVAYLAGPE
SGYITGANLMIDGGFSA