Protein Info for HSERO_RS19360 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): 2-keto-3-deoxyxylonate dehydratase (EC 4.2.1.141)
Rationale: Nearly identical to C785_RS13680 = WP_039786859.1, which was reported to be D-2-keto-3-deoxypentoate dehydratase by PMC6336799 (this is the same reaction). HSERO_RS19360 is also 55% identical to xylX from Caulobacter crescentus, which is also required for xylose utilization (PMC1855722) and is believed to have this activity as well.
Original annotation: fumarylacetoacetate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3877)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

D-xylose degradation V (4/5 steps found)
D-arabinose degradation III (4/6 steps found)
D-xylose degradation III (3/5 steps found)
superpathway of pentose and pentitol degradation (19/42 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS12 at UniProt or InterPro

Protein Sequence (391 amino acids)

>HSERO_RS19360 2-keto-3-deoxyxylonate dehydratase (EC 4.2.1.141) (Herbaspirillum seropedicae SmR1)
MAHTFSLQAHLPEDHAQATLIGRIWQPGVGPVLVRIDADGAYDLTLIAATSSELLELDNP
AAAVRSATNMTRIATLQELLDNADAAGRDTSRPWLLAPIDLQAVKASGVTFVASMLERVI
EEQARGDAGKAESVRKAITAVIGDNLSSVVPGSPEAARLKEVLLDQGVWSQYLEVGIGPD
AEIFTKAQPMSSVGLGDEVGIHPKSAWNNPEPEIVLAINSRGKVVGATLGNDVNLRDFEG
RSALLLGKAKDNNASCAVGPFIRLFDANFSIDDVRRAELTMRVDGTEGFTLKGSSSMSMI
SRDPLQLVEHAIGPNHQYPDGLVLFLGTMFAPTQDRFGPGQGFTHQVADIVTISTPKLGA
LVNTVNFSDQTAPWTFGLTALFKNLADRKLI