Protein Info for HSERO_RS19275 in Herbaspirillum seropedicae SmR1

Annotation: acyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 28 to 103 (76 residues), 58.4 bits, E=3.7e-20

Best Hits

Swiss-Prot: 44% identical to Y511_ZYMMO: Uncharacterized acyl-CoA thioester hydrolase ZMO0511 (ZMO0511) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 100% identity to hse:Hsero_3861)

Predicted SEED Role

"Acyl-CoA hydrolase (EC 3.1.2.20)" (EC 3.1.2.20)

MetaCyc Pathways

• palmitoleate biosynthesis IV (fungi and animals) (2/2 steps found)
• acyl-CoA hydrolysis (1/1 steps found)
• firefly bioluminescence (3/14 steps found)
• jasmonic acid biosynthesis (5/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

See D8IRZ6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>HSERO_RS19275 acyl-CoA hydrolase (Herbaspirillum seropedicae SmR1)
MSSTVPELPPGKAPQLRVMPMPSDANVYGDVFGGWIMAQVDIAGSLPATRRANGRVATIA
VNSFLFKNPVFVGDLLSFYADIVKVGNTSITVNVEVYAERNRLQTEIVKVTEATLTYVAT
DENRKPRPLPPLDPSREAGLNPVL