Protein Info for HSERO_RS19270 in Herbaspirillum seropedicae SmR1

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 40 to 313 (274 residues), 150 bits, see alignment E=1.1e-47 PF00005: ABC_tran" amino acids 379 to 527 (149 residues), 112.9 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 46% identical to AB23B_ARATH: ABC transporter B family member 23, mitochondrial (ABCB23) from Arabidopsis thaliana

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to hse:Hsero_3860)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRZ5 at UniProt or InterPro

Protein Sequence (634 amino acids)

>HSERO_RS19270 metal ABC transporter permease (Herbaspirillum seropedicae SmR1)
MRRYPNSSSSPQAPIQRQRGDWEVVRTLLPYLWTYKWRVLLALAFLVGAKLANVGVPLVL
KRLVDAMTITPTHPQALLVLPLGLLVAYGALRLATALFTELRELMFARVTQRAVRTIALQ
VFRHLHALSLRFHLNRQTGGMTRDIERGTRGVSSLVSYTLFSILPTLIEIALVLAYLITH
YDVWFSVITAGALVCYILFTITVTEWRTHFRRTMNELDSHANTRAIDSLLNYETVKYFGN
EEFEARRYDEGLQRYERAAVKSQSSLSLLNTGQSAIIAIAVTLILWRATVGVIDGSMTLG
DMVLVNAFMIQLYIPLNFLGVLYREIKQSLADMERLFSLLEEHREVADSADAKPLKTQGA
NLHFDHVDFSYERNRQILFDVDFTVQAGTTTAVVGHSGSGKSTLSRLLYRFYDVDAGAIR
IDGQDLRTVTQASLRQAIGIVPQDTVLFNDTIEYNIAYGKPGATREQIVAAAKAAYIHDF
IESLPDGYASMVGERGLKLSGGEKQRVAIARTLLKDPAILIFDEATSALDSRAEQAIQQQ
LEEIARERTTLVIAHRLSTIVNAQQILVLDHGRIVERGTHAGLLMAGGLYAQMWLRQQAG
ADEEGGSPAPLLEAVAAPAEPGAEPSVMLPAQQR