Protein Info for HSERO_RS19250 in Herbaspirillum seropedicae SmR1

Annotation: glutamate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 120 (99 residues), 60.1 bits, see alignment E=1.2e-20 PF00528: BPD_transp_1" amino acids 43 to 231 (189 residues), 70 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 43% identical to GLTJ_ECOLI: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli (strain K12)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 100% identity to hse:Hsero_3856)

MetaCyc: 43% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRZ1 at UniProt or InterPro

Protein Sequence (249 amino acids)

>HSERO_RS19250 glutamate ABC transporter permease (Herbaspirillum seropedicae SmR1)
MHYNWNWGIFWEMSPDGIPYIDTLLAGLKWTLATAACAWIMALILGTIFGTLRTTTKPWV
VRIANGYVELFRNIPLLVQMFLWYFVMPELLPAFIGDWIKSLPDASFVTATLALGFFTSS
RVAVQVTTGIQALPRGQRMAGAALGLTPVQTYRYVLLPMAFRIIIPALTNEFAAIIKNSS
VALTIGLVELTAATYSMREFTFQTFEALTGATIIYVIISVIALFMARLLEKVTAVPGYIT
GGSTSAGGH