Protein Info for HSERO_RS19165 in Herbaspirillum seropedicae SmR1

Annotation: chemotaxis protein CheA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 PF01627: Hpt" amino acids 152 to 220 (69 residues), 48.4 bits, see alignment E=1.4e-16 PF02518: HATPase_c" amino acids 446 to 580 (135 residues), 54.3 bits, see alignment E=2.6e-18 PF01584: CheW" amino acids 588 to 713 (126 residues), 55.7 bits, see alignment E=6.3e-19

Best Hits

KEGG orthology group: K02487, type IV pili sensor histidine kinase and response regulator K06596, chemosensory pili system protein ChpA (sensor histidine kinase/response regulator) (inferred from 100% identity to hse:Hsero_3839)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRX4 at UniProt or InterPro

Protein Sequence (729 amino acids)

>HSERO_RS19165 chemotaxis protein CheA (Herbaspirillum seropedicae SmR1)
DLPANDALQETLQPLLKILRQQGSSWRARVDSGLVCPAPPLYLRTLTAVRDCTRSAGAAD
LEACASAILRVLECAQPPGQGLDIPALDIIERAVAALAQRGSNRVALEELAALSQPPRMR
SSPAARDTAPAPWLAPREQQWEGLQDELDQALLPVFLEEAQELMSSIGEGLEALRQGVAD
AELAGLARPLHTLKGSARMVGARRLSHCLHQMETALRGVQTGIEGVHDRSSATLAALETL
LGLHDLALDHFAALTQAALLLSADGGARAPVLPAPLIRIRTTVLDKLLNQVGEVSIARSR
LDNEVGSLQSESKALGEQLMRLSGELRQWLRQSGTQAQDGGDAAAAMQALAHSLAARLEQ
ASLHQRRLQEGVSSTREGLRQQAAHTRELQQELMYARMVKFNSMEVRMQHLVRQVAAETG
KPLALDLSNCRLQIDRAILERLMGPLEHLLRNAAVHGIESAEQRLAEGKPAVGRLTVQAT
HEGNEAVIRVSDDGRGLDLEAIRQKALELGAAGLAEASQARLADLIFQPGLSTSPQVSAL
AGRGIGMDVVRSEVAALGGWMRVHSQPGQGVQFTLYLPLSLAVQHVCLLRHGQQHFAIPS
MLVDSIVQLRGPQARQALAERSLEHQGSRLALHPWHCLLDEAPEPAGEGSDSAYVLLIKR
DDGLMAVLADHVSGNREVVVKPVGPQLATLAGVVGATVLGDGQIVLIINPLLLAGAGRTD
GMAVAPGVQ