Protein Info for HSERO_RS18950 in Herbaspirillum seropedicae SmR1

Annotation: glycerol-3-phosphate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 292 (207 residues), 64.1 bits, see alignment E=7.6e-22

Best Hits

Swiss-Prot: 60% identical to UGPA_RHIME: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to hse:Hsero_3794)

MetaCyc: 58% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRS9 at UniProt or InterPro

Protein Sequence (294 amino acids)

>HSERO_RS18950 glycerol-3-phosphate transporter permease (Herbaspirillum seropedicae SmR1)
VEKRARFTSKWLPYLLVAPQIIITLLFFFWPAVQALYQSMLLQDAFGGYSEFVWFDNFKT
LFGDPTYLESFRTTAIFSALVAFFGLALSLLLAVFADRVRRGASIYKTFLIWPYAVSPVV
VGVLWMFLLSPSLGILSHVLSWLGLPWDYMINGTHAMILIVIAAIWKQISYNFLFFLAGL
QSIPKSLIEAAAIDGAGPVKRFFTIVFPLISPTTFFLFVVNVVYAFFDTFVIVDATTHGG
PGKDTEILVYKVFSDGFKGGDLGGSAAQSVVLMALVILLTVVQFKYVEKKVQYA