Protein Info for HSERO_RS18940 in Herbaspirillum seropedicae SmR1

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 112.4 bits, see alignment E=4.2e-36 PF17912: OB_MalK" amino acids 239 to 291 (53 residues), 40.4 bits, see alignment 6.6e-14 PF08402: TOBE_2" amino acids 284 to 355 (72 residues), 38.2 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 61% identical to UGPC_BORPE: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 100% identity to hse:Hsero_3792)

MetaCyc: 55% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter ATP-binding subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.20

Use Curated BLAST to search for 3.6.3.20 or 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRS7 at UniProt or InterPro

Protein Sequence (364 amino acids)

>HSERO_RS18940 sn-glycerol-3-phosphate ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MAAIHLKQVRKTYGAGTKAVDVIHGIDAEIADGEFIVMVGPSGCGKSTLLRMVAGLEEIS
SGQIVIGDRVVNDLEPKERDIAMVFQNYALYPHMTVYQNMAYGLKIQGLSKSEIDARVQR
AAAILELGALLERTPRQLSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRLEI
QKLHASLRTTSLYVTHDQVEAMTLGQRMIVMNRGVAEQIGTPAEVYARPATTFVASFIGS
PPMNLLQGKLSADGASFEVSKGNASDILRLPQPLTGAAGQERILGVRPEHLLPILDGSAA
QLSLEVELVEALGAELLVHARCGGQALVLRCPANVQVRTGQRIGASFGAGDVHWFDVKST
RRIG