Protein Info for HSERO_RS18410 in Herbaspirillum seropedicae SmR1

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 TIGR00717: ribosomal protein bS1" amino acids 2 to 503 (502 residues), 668.8 bits, see alignment E=2.5e-205 PF00575: S1" amino acids 3 to 68 (66 residues), 28.3 bits, see alignment E=3.8e-10 amino acids 86 to 154 (69 residues), 45.2 bits, see alignment E=1.9e-15 amino acids 172 to 243 (72 residues), 81.6 bits, see alignment E=8.7e-27 amino acids 259 to 330 (72 residues), 72.9 bits, see alignment E=4.7e-24 amino acids 344 to 417 (74 residues), 65.8 bits, see alignment E=7.5e-22 amino acids 433 to 503 (71 residues), 64.5 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 75% identical to RS1_NEIMB: 30S ribosomal protein S1 (rpsA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to hse:Hsero_3689)

MetaCyc: 65% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR41 at UniProt or InterPro

Protein Sequence (542 amino acids)

>HSERO_RS18410 30S ribosomal protein S1 (Herbaspirillum seropedicae SmR1)
MRSGEVISAEVVRLDHNFVIVNAGLKSEAFIPVEEFKNDNGEVEVNVGDFISVAIESLEN
GFGDTILSRDKAKRLASWLSLEKAMESGEIVTGTVNGKVKGGLTVLTNGIRAFLPGSLVD
TRPVKDTTPFEGKTLEFKVIKLDRKRNNVVLSRRAVIEASMGEERAKLMETLKEGTVVTG
IVKNITDYGAFVDLGGIDGLLHITDLAWRRVRHPSEVLSVGQEITAKVLKYDQEKNRVSL
GVKQLGDDPWTGLSRRYPQGTRLFGKVTNLTDYGAFVEVEQGIEGLVHVSEMDWTNKNVA
PNKVVQLGDEVEVMVLEIDEERRRISLGMKQCKPNPWDDFAMSHKKGDKVKGSIKSITDF
GVFIGLPGNIDGLVHLSDLSWTEAGEEAVRKFKKGDELEAVVLAIDVERERVSLGVKQLE
GDPFNNFAALNDKGAIVTGTVKSVEPKGAVIQLTDEVEGYLRASEISRDRVEDAGTHLKV
GDSVEALVINIDRKARSIQLSIKAKDNAETQEAMQKMSADSNAASGTTSLGALLKAKLDN
KN