Protein Info for HSERO_RS18390 in Herbaspirillum seropedicae SmR1

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 182 (182 residues), 223.3 bits, E=4e-70
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 433 (433 residues), 429.2 bits, E=7.4e-133
• PF02558: ApbA
  • amino acids 3 to 106 (104 residues), 26 bits, E=1.3e-09
• PF00984: UDPG_MGDP_dh
  • amino acids 209 to 301 (93 residues), 124.5 bits, E=3.1e-40
• PF03720: UDPG_MGDP_dh_C
  • amino acids 325 to 437 (113 residues), 103 bits, E=2.2e-33

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to hse:Hsero_3685)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

See D8IR37 at UniProt or InterPro

Protein Sequence (459 amino acids)

>HSERO_RS18390 UDP-glucose 6-dehydrogenase (Herbaspirillum seropedicae SmR1)
MKITIIGTGYVGLVTGACLAELGNDVFCLDVDQRKVDILNNGGIPIHEPGLEEVVERNRA
AGRLQFSTDVAASVAHGDIQFIAVGTPPDEDGSADLQYVLAAARNIGRYMEGFKVVVDKS
TVPVGTADRVKAAIADELAQRGKTELSFSVVSNPEFLKEGAAVEDFMRPDRIVIGHDQSP
EGLHAQTLMKKLYAPFNRNHERTYWMDVRSAEFTKYAANAMLATRISFMNELANLADKVG
ADIESVRHGIGSDPRIGHSFLYAGCGYGGSCFPKDVQALERTARDYDQSLLILRAVEQVN
DLQKHVLGKKVVARFGEDLAGKHFALWGLAFKPNTDDMREASSRVLIGELVRRGATVAVY
DPVAMKEASRVLQLDFADDAALLQRIRFGTSPMDTLQDADALAIVTEWKAFRSPDFERVK
ATLKNPVIFDGRNLFDPQLMADSGIEYYGIGRSLLARGQ