Protein Info for HSERO_RS18325 in Herbaspirillum seropedicae SmR1

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 408 (391 residues), 195.6 bits, see alignment E=1.2e-61 PF00083: Sugar_tr" amino acids 44 to 190 (147 residues), 22.6 bits, see alignment E=4.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3672)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR24 at UniProt or InterPro

Protein Sequence (519 amino acids)

>HSERO_RS18325 major facilitator transporter (Herbaspirillum seropedicae SmR1)
MSLRLSTSAGRILLTGSFGCAMTVLDTNVVGIILPTVARDLGASFSQIEWVVSSYVLCFA
ALLLPAGATADRYGRRRVLLGGIALFALTSLACALAPSAQALYGARALQGVGAAFLLAPA
LAVIGHAFHDEDQRERAWALWGGIMGLTMVLAPLIGGVVNTLLGWRWAFAVNLPACLLLA
VAVWRHVPESRNPLPRPLDPLGILSSSSAVFLLTWALITGPEHGWTSVACVARGLGGALL
LVLFIAWQRRAAHPMLELSLFRHAGFVAAVAAMFAYAASAQVMASLLPLFLQNARGLSAW
QTGLAMLPFALAMLLLPQVGSRLARWLSSPQMLALGLGVTALGNLLMIQAALSGAAAWTA
LGMAVLGSGGGLLNGQTQKAIMGNVPRERAGMASGISTTARFTGVLAGFAGLGAVLADTA
RHAMQNALAALDASASAAAFVERAMAGDLAQAAALLPQHGQAAVMLARQAYAQGFAHAFA
AAALLAVATALLVLWSIRRTARPAARPGAAARLRRPPGA