Protein Info for HSERO_RS18295 in Herbaspirillum seropedicae SmR1

Annotation: 3'-RNA processing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR02439: catechol 1,2-dioxygenase" amino acids 3 to 284 (282 residues), 441.1 bits, see alignment E=6.7e-137 PF04444: Dioxygenase_N" amino acids 22 to 90 (69 residues), 86.4 bits, see alignment E=9.6e-29 PF00775: Dioxygenase_C" amino acids 100 to 283 (184 residues), 214.5 bits, see alignment E=8.8e-68

Best Hits

Swiss-Prot: 71% identical to CATA2_ACILW: Catechol 1,2-dioxygenase 2 (catA2) from Acinetobacter lwoffii

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 100% identity to hse:Hsero_3666)

MetaCyc: 56% identical to catechol-1,2-dioxygenase (Pseudomonas reinekei)
Catechol 1,2-dioxygenase. [EC: 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.1

Use Curated BLAST to search for 1.13.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR18 at UniProt or InterPro

Protein Sequence (303 amino acids)

>HSERO_RS18295 3'-RNA processing protein (Herbaspirillum seropedicae SmR1)
VDKKAIDAVLQKIESTELAEGNQRVKTVVNRLVRDMFYTIEELDVQPEEFWAAVDYLTSA
GKSGEFGLIAAGLGFEHFLDLRMDEAEARRGVQGGTPRTIEGPLYVSGAPEQKGFARMDK
DPQPGDTLFMQGQVFDEHGKPLANALVEVWHANHLGRYSFFDPDQSPFNLRCSIRTDEQG
RYRFRSRVPVGYSVPPGGATDRLLTKLGRHGSRPAHIHFFVTVPGYRKLTTQINIAGDPY
LWDDFAFATREGLVPELKHVTDPAEIRKHEVDAPFYAIEFNFNLLPEQADLPKADINRPR
LAA