Protein Info for HSERO_RS18275 in Herbaspirillum seropedicae SmR1

Annotation: CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3- dehydrase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF13806: Rieske_2" amino acids 3 to 100 (98 residues), 50.7 bits, see alignment E=3.2e-17 PF00355: Rieske" amino acids 3 to 90 (88 residues), 69.4 bits, see alignment E=3.9e-23 PF00970: FAD_binding_6" amino acids 126 to 217 (92 residues), 46.7 bits, see alignment E=6.8e-16 PF00175: NAD_binding_1" amino acids 228 to 333 (106 residues), 65.9 bits, see alignment E=9.6e-22

Best Hits

KEGG orthology group: K14578, naphthalene 1,2-dioxygenase system ferredoxin subunit (inferred from 100% identity to hse:Hsero_3662)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR14 at UniProt or InterPro

Protein Sequence (360 amino acids)

>HSERO_RS18275 CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3- dehydrase reductase (Herbaspirillum seropedicae SmR1)
MSEWFDVGHADDFAEGEVAAARAGGQAVAVFRLGEEIFALKDLCTHGNAKLSDGYVEDGC
VECPLHQGLFDIRSGAPRCAPVTEAVRSFPVRVVAGRVEIGVGGEGGGGDVLTVASPAPA
AQQVQATLESLTRAAPDVAILRLRCAAPLSYRAGQYIDLLLEDGQRRSYSMATYAKDGSD
LLELHVRHLPGGLFTDRLFNGMQPGQQFSLEGPAGSFFMREGTQPLILLASGTGFAPVKA
LVEEAIASGSTRAMRLYWGGRRAADLYLDALCRDWAASLPWFDYVPVLSEADATSGWSGR
TGLVHRAVMQDVPAMQQYQVYACGAPVVVESARRDFTAACGLSETAFFADAFVSRADLRK