Protein Info for HSERO_RS18260 in Herbaspirillum seropedicae SmR1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 292 (264 residues), 127 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_3659)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR11 at UniProt or InterPro

Protein Sequence (317 amino acids)

>HSERO_RS18260 branched-chain amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
MQRLFIPLLLVLALLLPLLAQASGMEYYIGVLTRILIFAMVAASLNFILGYGGMVSFGHA
VFFGLGAYVTAIASFHGVTSAWLIWLLAALVTALVGLVIGVIALRTRAVYFIMITMALAQ
LFYYFFVGFRYYGGDDGLQVTARPLLGFGLDMSGDNAFYWVVLAWLAASFILLQRLLASR
FGLALNAIRQNERRAQAIGYPALRYKLAAFVIAAVIAGIAGSLIGMSNLFASPKLLHWSQ
SGILLVMVALGGVGYFYGGLLGAAAFLLLEEVLSTHFEYWQIYVGLILLLVVMVAPRGVS
SLVSIGKTLKQGEQHGA