Protein Info for HSERO_RS17770 in Herbaspirillum seropedicae SmR1

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR00125: cytidyltransferase-like domain" amino acids 10 to 66 (57 residues), 28.8 bits, see alignment E=1.1e-10 PF01467: CTP_transf_like" amino acids 12 to 193 (182 residues), 81.1 bits, see alignment E=4.4e-27 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 12 to 219 (208 residues), 156.6 bits, see alignment E=7.7e-50

Best Hits

Swiss-Prot: 70% identical to NADD_HERAR: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Herminiimonas arsenicoxydans

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to hse:Hsero_3560)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQC7 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HSERO_RS17770 nicotinate-nucleotide adenylyltransferase (Herbaspirillum seropedicae SmR1)
MAPPAAQRCIAVLGGSFDPVHNGHVRLAEHFVQLLQPDELRIIPAGNPWQKHGLQARPAD
RVEMVRRAFDRQQVPVVIDEQEIRRASATYTIDTLRALRAELGPQVSIVFLMGADQLQHL
DTWQHWQELFDLAHLCAASRPGFELADAHVPPAVREEFKRRNAAPQEIRSTTHGYGYLAL
GLAVDISSTEIRAQLQRGTRPDSLIPGRVLDYIEQQHLYRN