Protein Info for HSERO_RS17710 in Herbaspirillum seropedicae SmR1

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF02743: dCache_1" amino acids 49 to 279 (231 residues), 56.7 bits, see alignment E=2.6e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 343 to 513 (171 residues), 175.2 bits, see alignment E=4.7e-56 PF00990: GGDEF" amino acids 347 to 509 (163 residues), 166.3 bits, see alignment E=5e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3548)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQB5 at UniProt or InterPro

Protein Sequence (525 amino acids)

>HSERO_RS17710 response regulator (Herbaspirillum seropedicae SmR1)
MHPLLAKAGSHARHSVARRARLFVVLICAAIAGGHLWQSMTARGVQLENNRSYSGNVAKA
LARHAYDVLQATDGLLLDMSDRIDSVGIAHARLVDLMPMLRRLSSEMPQLDGLYVFDEHG
KRLLTSSAPPLAPANNSDRDYFIWHRDHDDVGPHVGKALLSRSTGRWIIPMSRRLNHPDG
SFAGVLLATLDINHFNQLYRTVEIGKGGSIALLLRDGTLLTRMPFDPGYINRDFSQGRLF
LEGLPHSPFGYLEVVSPLDARQRFLSYQAVDKYPLVLVVTLAREEALADWKQQTFVYGAA
VLLLLAIIGVFGWRLVGQIELRLRAEDRALQAMGELQMANHRLEMLAHQDGLTGLANRRH
LDTMLETEFKRAERSGAALALIMIDVDFFKQYNDLYGHQAGDECLRRVAGVLKERQRRPG
DLAARYGGEEMAMLLPGTDAEGACAVAEKLRAGIQALELPHRGNPVGVVTVSVGVCALEL
LPSAARSVQALLGAADAALYEAKHEGRNQVRLAAPMKTAPSGAVS