Protein Info for HSERO_RS17635 in Herbaspirillum seropedicae SmR1

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF04542: Sigma70_r2" amino acids 22 to 84 (63 residues), 32.4 bits, see alignment E=6.6e-12 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 170 (148 residues), 50.7 bits, see alignment E=7.7e-18 PF08281: Sigma70_r4_2" amino acids 116 to 168 (53 residues), 33.9 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 40% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3533)

MetaCyc: 40% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQA0 at UniProt or InterPro

Protein Sequence (178 amino acids)

>HSERO_RS17635 RNA polymerase sigma-70 factor (Herbaspirillum seropedicae SmR1)
MSSYPISDHPPAMSRIEAIFIEHHGWLRTRLRRSVGDAFTAEDVAAETFTQLLHSPPPQE
VREPRALLTTISRRIVYELWRRRDLEEACLQALAHVSGDVQAISPEDQLQLLQALRAMDQ
ALAGLSAKECAAFLLYKLDGLTYQAIGAQLRITPSVARRYVAKGLLQCYKAAGFAPLE