Protein Info for HSERO_RS17570 in Herbaspirillum seropedicae SmR1

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 140 to 164 (25 residues), see Phobius details PF02627: CMD" amino acids 45 to 107 (63 residues), 25.5 bits, see alignment E=5.5e-10

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 100% identity to hse:Hsero_3519)

Predicted SEED Role

"Cation/multidrug efflux pump"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQ86 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HSERO_RS17570 4-carboxymuconolactone decarboxylase (Herbaspirillum seropedicae SmR1)
MTKSNRLPAIVREQMTSEQTAMLDAILAGPRKNLNGPFVAWIHSPALGELAQRLGAFCRY
ETGLPLRLSELAILATAAAWQSQAEWHIHLPIAVEAGILPDVAEQIRQGATPDFPLEDER
VIWNFANELYRDKRVSERTYAAAVAMFGLPVVVNLVGLLGYYALVAMTLNAFGMRAEGQG
EGDLPFAETVL