Protein Info for HSERO_RS17290 in Herbaspirillum seropedicae SmR1

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 149 to 176 (28 residues), see Phobius details PF02417: Chromate_transp" amino acids 20 to 177 (158 residues), 125.9 bits, see alignment E=8.3e-41

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to hse:Hsero_3453)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPN6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>HSERO_RS17290 chromate transporter (Herbaspirillum seropedicae SmR1)
MMMSTPDLLAPERPVPTTRELFLGFLGLGMTAFGGALPLAHRMIVERRKWLTDPEFVELL
GLCQFLPGGNIINLSVALGMKFRGWKGALAGVTGLIAVPSMVVILLGMIYQHFQHDPNVK
HLFAGLAAAAAGLLIQMAVKIALPLRKNLVLAGVAVVCFVAIALLRIPLLWVMLVMTPIS
VVLTARYGERFAAKPQSVPVQDEGKKEGAQ