Protein Info for HSERO_RS17265 in Herbaspirillum seropedicae SmR1

Annotation: glucosyltransferase MdoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 882 transmembrane" amino acids 206 to 224 (19 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details amino acids 557 to 586 (30 residues), see Phobius details amino acids 612 to 635 (24 residues), see Phobius details amino acids 642 to 662 (21 residues), see Phobius details amino acids 667 to 684 (18 residues), see Phobius details amino acids 705 to 721 (17 residues), see Phobius details amino acids 727 to 747 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 291 to 473 (183 residues), 53.2 bits, see alignment E=5.5e-18 PF13506: Glyco_transf_21" amino acids 357 to 511 (155 residues), 24.6 bits, see alignment E=2.5e-09 PF13632: Glyco_trans_2_3" amino acids 387 to 582 (196 residues), 44.7 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to hse:Hsero_3448)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPN1 at UniProt or InterPro

Protein Sequence (882 amino acids)

>HSERO_RS17265 glucosyltransferase MdoH (Herbaspirillum seropedicae SmR1)
VELHITPQLRQTSAASQALDDYLARLPLSPEQRQDLAARAGAIGSGDPVADLHRVLAEAS
GLDASQAGPAAQASVDARLRLLYPAATPSAVPAAQAALTVQGAPVPPIGQERGQPRIPVG
PPMHRKSMVPRPWGELNPFSRWVEEENRRLERRPSRWRRARKGRAKVVETPPPVDDEPRY
IEDHLDQSEAPDPKGHWQHTGNVRRITLLILMVLQTSMATYFMSDVLPYHGTKPLEMVVL
FLFGLLFLWVSAGFWTAMTGFLVLMRGDDKYLISHEKAGNTEIAPEARTAIVMPICNEDV
ARVFAGLRATYESLERTGQIQHFDFFILSDSGEADICAAETAAWNRLCRETGGFGRIFYR
HRRRRVKRKSGNLDDFCRRWGADYRYMVVLDADSVMTGECLTKLTRLMEAHPGAGIIQTA
PRAAGRDTLYARIQQFSTRVYGPLFTAGLHYWQLGESHFWGHNAIIRLQPFMKHCALAPL
PGKGNLSGPIMSHDFVEASLMRRAGWSVWIAYDLDGSYEEMPPNLLDELSRDRRWCQGNL
MNFRLFLARGMHIVHRAVFVTGVMAYVSAPLWGLFLILSTVLLAAHTLIDPQYFTSPRQL
FPIWPEWHPEKALALVSATATILFLPKILAVLLFAVKGARGFGGALALFLSMVIELLFSM
VLAPVRMLFHTRFVLGAFLGWNAGWKSPPRADNETGWGEAMRRHGWHSLLGVAWGALVYW
LNPSFIWWLIPIAGSLAVSVPVSVLSSRVTYGRGFRRAGLFKIPEETSPPFELRETVRLL
QETPPLPGFVEAVVDPSFNALVCATAHAHPQVPQFTQHLREKLVRTALREGPDALSDKQK
NSILEEPGLLSQLHQAVWSGAPEIHPDWRVALGQQVPQALAA