Protein Info for HSERO_RS17260 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 64 to 391 (328 residues), 170.1 bits, see alignment E=3.1e-54 PF16576: HlyD_D23" amino acids 73 to 323 (251 residues), 80.4 bits, see alignment E=1.8e-26 PF13437: HlyD_3" amino acids 213 to 319 (107 residues), 52.1 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to hse:Hsero_3447)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPN0 at UniProt or InterPro

Protein Sequence (396 amino acids)

>HSERO_RS17260 membrane protein (Herbaspirillum seropedicae SmR1)
LPRAIMTEPHDPLPHIVPTTHAPTRQKAWWSSVALVIVLGGGYWLYSRQQPPPPAPKPIP
VKLETVTVERADLEQVVNATGNVVAQDYVDVGSKVAGQISDVDVVVGETVKAGKLLATVA
PAVQSSRIENNRATLARLKAELAGQNAQLDFAQLQFQRQTQLKAENATREESYESSRMNM
YAAAARVDATNAQIQQTEAAIREDEAVQKQTRIEAPVSGTIVTLNARPGQMVAANQEALM
RIADLSRMTVQVPVAEEDVTRLQKGMTAYFTTPGYPGKRWSGKLRQIMLLPTDDSGRQGK
KAFYTVFFDVANPSRELMSGMSADVYFVLARAEHVPTIPRTLVTKPGMDGTQTVKVVLAD
GKLETRKIKIGIRDNERAQVLSGLKEGEQVLLPANP