Protein Info for HSERO_RS17135 in Herbaspirillum seropedicae SmR1

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 149 to 176 (28 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 162 to 345 (184 residues), 89.2 bits, see alignment E=2.8e-29

Best Hits

Swiss-Prot: 53% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to hse:Hsero_3421)

MetaCyc: 53% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPK4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>HSERO_RS17135 peptide ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSTTTSPAPSISPGRRIWLRFCADRAGYWSLWLFSLLFVLSLGAELISNDRPLMARYQGK
LIFPIVQDYSDKSFGGDFDSPADYLDPFIQAQLRKDGNWVLYPPNRYGYNTLNYFAKQPN
PAAPSSENWLGTDDRGRDVFARLLYGFRVSVLFGMALTFIGVVLGVAAGAVQGYFAGRTD
LFTQRLLEIWGSMPELYLLIIFSSIFQPSLGLLLVLLSLFGWMSLSDYVRADFLRNRNLE
YIQAARAMGLPDRLIIWRHVLPNSMTTVVTFLPFRMSAAILALTSLDFLGLGVPPSTPSL
GELLAQGKNNLDAWWIALSTFVVLTVTLLLLTNIGNALRNALDVRRKA