Protein Info for HSERO_RS17010 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): ABC transporter for D-sorbitol/xylitol, permease component 2
Rationale: Specifically important for utilization of D-sorbitol and xylitol.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 209 to 213 (5 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 262 (177 residues), 60.7 bits, see alignment E=7.8e-21

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_3395)

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPH9 at UniProt or InterPro

Protein Sequence (270 amino acids)

>HSERO_RS17010 ABC transporter for D-sorbitol/xylitol, permease component 2 (Herbaspirillum seropedicae SmR1)
MGRLITRCAVWGVGIVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENYRQVIG
SPEVLVGLTNSAVIVGSAVLLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVA
IPLIAIWVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAV
FWKIALPNCATTLLGGIIFSFVLVWNELMIALALTSSNSATLPVVASAFTSMGQEVPWGV
INASTVLLALPPLIFVGVLSRLLNSMLKGK