Protein Info for HSERO_RS17005 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): ABC transporter for D-sorbitol/xylitol, permease component 1
Rationale: Specifically important for utilization of D-sorbitol and xylitol.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 287 (205 residues), 51.1 bits, see alignment E=7.2e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_3394)

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPH8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>HSERO_RS17005 ABC transporter for D-sorbitol/xylitol, permease component 1 (Herbaspirillum seropedicae SmR1)
MFNRGKTSLPYLFLGPSLLVMLVLGLVPTVAAINLALKNRVLRYPDSDYVWLRNLERLMS
DRRFLNAIEVSAVWEVVTVLGAVIVGIAIAVYLFENVHGKWRQAMCVLLITPVLLPRVSA
AFIWKFMYSPLTGILGWLLGLVGIHDTAFLSDPALALYAVALVDIWQWGLFFAVIVLKLL
ETLPPEPLEAARLDYARTWQVYAYIALPMLKGPLISLVFIKMVESLRSFDLIYVMTKGGP
GVATETLDMYAYAQGIGLSGKVSYASTMAVLMMIATTLIFTLIWKRVSKWED