Protein Info for HSERO_RS16945 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 20 to 156 (137 residues), 115.1 bits, see alignment E=5.3e-37 PF00512: HisKA" amino acids 236 to 302 (67 residues), 54.5 bits, see alignment E=2e-18 PF02518: HATPase_c" amino acids 348 to 455 (108 residues), 99.4 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_3382)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J280 at UniProt or InterPro

Protein Sequence (459 amino acids)

>HSERO_RS16945 histidine kinase (Herbaspirillum seropedicae SmR1)
MTAMHSSIRRDLLKWLIAPLLLVNLIGAGLTYWLAWLPAQHAFDQNLMDSTWGLYAQVRH
RQERTTAELTQQAEQILRSNHSDTTFFAVRNTEGQIVVGDKGFPQLPASDVFDRPINYDG
EMRGEPVRIAAMQVRVKNGVIWVAVAETIRKRDRAHYTILLSFLVLDGALTFASIFVVLV
AVRRGLRPLKSLQRNLEQRDHGKLGAIDGRGAPVELQPLIVAMNELMARINKGEQAQQNF
MADVAHQLRTPLTGLKLQLELLHDKHQDQPDTARSLAMMNSSVERMIRQSRQLLALARSE
PGLFESRKLEELSLDKLVEESVQHFIEEADKKRIDLGFDLRPARLRGDRFLLSDLIDNLI
DNAVRYSPPHGTVTVRCLEEQDATVLSVEDSGPGIAPEHRELIFDRFYRANDKVAGSGLG
LAIVREIAHDHGGVISVDCKEQGQGTIFTVRFPLAPPAA