Protein Info for HSERO_RS16875 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 72 to 100 (29 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details PF05230: MASE2" amino acids 10 to 97 (88 residues), 101.3 bits, see alignment E=2.4e-33 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 177 to 342 (166 residues), 153.3 bits, see alignment E=2.5e-49 PF00990: GGDEF" amino acids 181 to 340 (160 residues), 136.9 bits, see alignment E=5.5e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3370)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J268 at UniProt or InterPro

Protein Sequence (343 amino acids)

>HSERO_RS16875 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
IGKGVRFVKRIYLLRTIGLGVGFFCVAAAFVQQPVAWPLWALLVFHGYLWPQVARAWALA
SRIPYRAERRNLVIDAAFGGFWIAAMQGNLVPSAVILSMLSMDNIAAGGLRLFMRGLYAS
IAACALGWWLLDAHWSPQSDLPTILACLPMMALYPLALGKSTYEMSKKLAERSRQFEVVS
QMDGLTHLFNRRYWESLLIEEFSQRRKAPGAQQKESFLLLLDLDHFKRINDTHGHLVGDE
VLRNFAQLLRIHLRKEDLIGRYGGEEFVVILRNIAHADALHLSQRLVERARASQDGVNKL
YGCTVSAGLVPFTSDMEAHFVWLQRADHAMYCAKANGRDRLVV