Protein Info for HSERO_RS16835 in Herbaspirillum seropedicae SmR1

Annotation: phosphatidylglycerophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 110 to 137 (28 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details PF04608: PgpA" amino acids 32 to 174 (143 residues), 129.9 bits, see alignment E=3.5e-42

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to hse:Hsero_3363)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J261 at UniProt or InterPro

Protein Sequence (180 amino acids)

>HSERO_RS16835 phosphatidylglycerophosphatase (Herbaspirillum seropedicae SmR1)
MNQASTPFPPPPAAPRKRKPTPHFMLAHPAHWIAQGFGSGLSPIMPGTAGTLFAWLSYAV
LSTRWPQVFTAANWLVIIAAGFIIGIWACQRTGQALNSPDDGSMVWDEIIAFWLVLVLVT
PASLKTQFAAFVVFRFFDMVKPPPIAWFDRRLKGGFGVMWDDIVAAFYTLLVFAFWRTYW