Protein Info for HSERO_RS16830 in Herbaspirillum seropedicae SmR1

Annotation: thiamine monophosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 4 to 319 (316 residues), 319.8 bits, E=8.2e-100
• PF00586: AIRS
  • amino acids 27 to 137 (111 residues), 107.8 bits, E=4.3e-35
• PF02769: AIRS_C
  • amino acids 149 to 301 (153 residues), 39.2 bits, E=7.9e-14

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to hse:Hsero_3362)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See D8J260 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HSERO_RS16830 thiamine monophosphate kinase (Herbaspirillum seropedicae SmR1)
MLSEFELIARYFSRPPAPDSRTALGVGDDCALMTPAPGMQLAISSDMLVCGRHFLPDADP
FTLGHKCLAVNLSDLAAMGAQPIAFTLALALPEARADWLEPFSRGMLALADAHGCELIGG
DTTKGPLTISITIFGEVPPQQALRRDAARAGDDLWVSGTLGDARLALAAYRQECSLNAEE
LALAAPRMHAPTPRVALGLALRGIAHAAIDISDGLAGDLGHLLQRSHVGATLDVDALPAG
AALQQRDLHLRRRFTLSGGDDYELCFSAPVRQRDAVYKAAQAAGTAVTRVGSIDAAPGLR
LLDASGEALQETPDSFDHFRS