Protein Info for HSERO_RS16820 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): 2-oxoglutarate:H+ symporter
Rationale: Specifically important for the utilization of alpha-ketoglutarate
Original annotation: alpha-ketoglutarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 33 to 228 (196 residues), 84.3 bits, see alignment E=1.4e-27 amino acids 234 to 426 (193 residues), 41.9 bits, see alignment E=9.9e-15 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 37 to 422 (386 residues), 448.2 bits, see alignment E=1.4e-138 PF07690: MFS_1" amino acids 75 to 291 (217 residues), 53.6 bits, see alignment E=2.7e-18 amino acids 278 to 436 (159 residues), 47 bits, see alignment E=2.7e-16

Best Hits

Swiss-Prot: 69% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to hse:Hsero_3359)

MetaCyc: 69% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"dicarboxylic acid transporter PcaT" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J257 at UniProt or InterPro

Protein Sequence (465 amino acids)

>HSERO_RS16820 2-oxoglutarate:H+ symporter (Herbaspirillum seropedicae SmR1)
VRPTQEISMSDTTQASTPLSAAEYRKRIFAILGASSGNLVEWFDFYVYSFCAIYFAPAFF
PKGDPTSQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRKTSMLISVLMMCGGSLAVAVM
PTYATIGAWAPALLLLARLFQGLSVGGEYGTSATYMSEVAPNGRRGFFASFQYVTLIGGQ
LLAVLVLFGMQQWLTKAELMAWGWRVPFVLGAVGALVAMYLRSSLAETSSAGARKKKDAG
TLKGLLQHKRAFLNVVGFTAGGSLMFYTFTTYMQKYLVNTAGMDPKVANGVMTGALFVYM
ILQPIFGAISDKIGRRNSMLCFAFFGMVGTFPILHFLKDVSSPGVAMALAILALTIVSFY
TSISGLIKAEMFPPEVRALGVGLSYAVGNAIFGGSAEFVALSLKSAGIESAFYWYVSALC
LVALIISLRMPDPQRDGHLKGDVAMNPDEHQGEADAAAGKLHKPA