Protein Info for HSERO_RS16815 in Herbaspirillum seropedicae SmR1

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 286 to 308 (23 residues), see Phobius details PF02743: dCache_1" amino acids 38 to 229 (192 residues), 45.6 bits, see alignment E=1.3e-15 PF00512: HisKA" amino acids 379 to 443 (65 residues), 35.9 bits, see alignment E=1.2e-12 PF02518: HATPase_c" amino acids 487 to 595 (109 residues), 83.2 bits, see alignment E=3.8e-27 PF14501: HATPase_c_5" amino acids 495 to 583 (89 residues), 23.3 bits, see alignment E=9.9e-09

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_3358)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J256 at UniProt or InterPro

Protein Sequence (600 amino acids)

>HSERO_RS16815 C4-dicarboxylate ABC transporter (Herbaspirillum seropedicae SmR1)
MRARRNLLILTLFLVATLLVCGITYRLALRKAEVDQKTQGAAQLQIAALDLESILQKYEA
LPFALGFQADVRQVLQHPDDVLAVDRLNRAFKTIQQQSQAVSIFMLDRRGLTLASSNWDD
EFSFVGRDFGFRPYFSEAVQGRAGRFYGIGNISSEPGYFIAQPIYRRQDQAEGDLPIGVM
VVKVDLAEFEHTWRSSADPITLTDAGGVVFLSNRPEWKYHSLQALSPPMQQALAGTHQYA
DLPITPVSALPPALQSGFGSHVSRPVGRLGWQLMLFPSQARMQRTAMLWTMACALLMLAL
AISLLAWYQHRRRLEERMASRDALRRAAAELEQRIAERTGQLTAANQALEARYEKLQQTE
SLLRTTQNELVQAGKLAMLGQMAAGVTHELNQPLTAIRAFADNAVKFLARGQSAQAVENL
EYISSASATMGKIIAQLKGFARKSGEAVACVDLSQAIEASSLLLASECQKLGATISIDIR
AAACVTGDVVRTEQVLVNLLRNALDAVEEAEHKRIAVVLEVAGGYALVRIRDSGGGIADE
VAPHLFEPFFTTKSSSKGLGLGLAISSSIVQAMNGQLSAHNHEEGGAEFVVRLPLLKMET