Protein Info for HSERO_RS16810 in Herbaspirillum seropedicae SmR1

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00072: Response_reg" amino acids 11 to 118 (108 residues), 91.1 bits, see alignment E=1.3e-29 PF00158: Sigma54_activat" amino acids 148 to 313 (166 residues), 219.3 bits, see alignment E=6.6e-69 PF14532: Sigma54_activ_2" amino acids 149 to 318 (170 residues), 71.1 bits, see alignment E=2.8e-23 PF07728: AAA_5" amino acids 171 to 286 (116 residues), 34.5 bits, see alignment E=4.9e-12 PF02954: HTH_8" amino acids 400 to 440 (41 residues), 39.8 bits, see alignment 7.4e-14

Best Hits

Swiss-Prot: 55% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to hse:Hsero_3357)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J255 at UniProt or InterPro

Protein Sequence (445 amino acids)

>HSERO_RS16810 Fis family transcriptional regulator (Herbaspirillum seropedicae SmR1)
MDKPGGAASALLIEDEQTVRRATAQALELGGFAVTACGSAEEALPLITRDFAGVVVSDVR
LPGLSGLDVLARVVAIDHDLPVIVVTGHGDVGMAVEAMRAGAYDFVEKPFSSDTLLEIAL
RAQEKRNLVLENRRLREAWAHDPELPPLVGQSPAIERVRTLIRSLGPADVDVLINGQTGT
GKEVVARQLHAASGRKGPFVALNCGALPETVFESEIFGHEPGAFTGAQKRRIGKLEYANG
GTLFLDEIESMPLALQVKLLRVLQERRLERLGGNESVAIDCRVVAASKADLLKLAAEGQF
REDLYYRIGVVAIDLPALNQRREDIALLLAHFCQAAAVRYRRESPAWSAAQMQQWQQRDW
PGNVRELRNFADRWVLGVEQMAASAVSSAVPVLSSLPEQVEQFEAGLIAAALKDSEGSVA
VAAERLGIPKKTLYDKIRKYQLAGS