Protein Info for HSERO_RS16570 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details PF03707: MHYT" amino acids 55 to 112 (58 residues), 86.3 bits, see alignment 1.7e-28 amino acids 118 to 175 (58 residues), 65.8 bits, see alignment 4.2e-22 amino acids 185 to 245 (61 residues), 25 bits, see alignment 2.3e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 263 to 424 (162 residues), 159.4 bits, see alignment E=3.4e-51 PF00990: GGDEF" amino acids 267 to 421 (155 residues), 171 bits, see alignment E=2.7e-54 PF00563: EAL" amino acids 442 to 677 (236 residues), 249.4 bits, see alignment E=4.7e-78

Best Hits

Swiss-Prot: 64% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3309)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J207 at UniProt or InterPro

Protein Sequence (695 amino acids)

>HSERO_RS16570 membrane protein (Herbaspirillum seropedicae SmR1)
MLIATYDKLLVVVSLLVAILASYTALDMAERINTTASQHGRAARWWLAGGAVAMGLGIWS
MHFIGMLAFRLPIALGYDAGITALSLVIAIAVSGFALWIVTRPELPTRRLLGSALFMGIG
IACMHYTGMAALRMQPGIAYDLFLFLASVAIAIAASAAALWIAFSLRRNTPHVRAARGGA
SVVMGIAIFGMHYTGMGAASFSRDSICLSAREGVAPGWLAVLIIVVTLAALTIALLTSVL
DARLESRTAKLARSLAAANEELTQMVLHDQLTRLPNRTLLEDRLNQAINKAAREQGHFAL
MFMDLDGFKAINDSLGHHVGDRLLVEVAQRLTSSSRANDTVARLGGDEFVILVDLNTPED
AMGVAEKLVEAVNQPFKVDQHELRVSASVGIAIYPEDGATRHDLVINADAAMYHTKRSGR
NGYHFFEPSMNANAQQQLQWLQDLRVALERGQFRLVYQPKFSLPAGPVLGAEALLRWEHP
VHGLVAPDQFIGLAERSGLILPIGAWVLDEACRQMREWFALGYVDWTMSVNLSALQFADP
HLLEVVRTTLERHQLPPPCLTLEVTESTAMHDTEASLQTLRQIADLGVEISIDDFGTGYS
SLLYLKRLPANELKIDRGFVRELRQDGEDAAIVSAIVALGRTLNLRIVAEGVETVEQQDF
LTAAGCDALQGYLMGRPMTPELFLQTMRERHKSAA