Protein Info for HSERO_RS16550 in Herbaspirillum seropedicae SmR1

Annotation: NAD(P)H quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 18 to 210 (193 residues), 151.3 bits, see alignment E=1.7e-48 PF03358: FMN_red" amino acids 25 to 156 (132 residues), 40.1 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 65% identical to NQOR_PSEAE: NAD(P)H dehydrogenase (quinone) (PA0949) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to hse:Hsero_3306)

Predicted SEED Role

"Flavoprotein WrbA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J204 at UniProt or InterPro

Protein Sequence (214 amino acids)

>HSERO_RS16550 NAD(P)H quinone oxidoreductase (Herbaspirillum seropedicae SmR1)
MTTSATSSTAVNAASNATILVLYYSRHGATRKLAELIAQGVESVPGCDARLRTVPAVSTV
AEAVEPDVPASGAPYVEASDLEECDGLALGSPTRFGNMAAAMKYFWDGTAPQWLSGALTG
KPACVFTSTGSLHGGQEATLLSMMIPLLHHGMLLVGLPYSHPELMNTHSGGTPYGASHWA
GVNGNQPLSDDSRTLAIALGKRLAENAIKLRRPS