Protein Info for HSERO_RS16530 in Herbaspirillum seropedicae SmR1

Annotation: glycerol acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 403 to 403 (1 residues), see Phobius details amino acids 406 to 438 (33 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 325 (307 residues), 58 bits, see alignment E=1.2e-19 PF05977: MFS_3" amino acids 65 to 330 (266 residues), 50.7 bits, see alignment E=1.6e-17 PF01553: Acyltransferase" amino acids 443 to 571 (129 residues), 102.3 bits, see alignment E=2.7e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3302)

Predicted SEED Role

"Lysophospholipid transporter LplT / 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) / Acyl-[acyl-carrier-protein] synthetase (EC 6.2.1.20)" (EC 2.3.1.40, EC 6.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.40 or 6.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J200 at UniProt or InterPro

Protein Sequence (629 amino acids)

>HSERO_RS16530 glycerol acyltransferase (Herbaspirillum seropedicae SmR1)
MQKNSQFTLFTQRRFAPFFWTQFLGALNDNVFKTALLTILTYDALSWTDLDPGLLNNLIP
GLFILPFFLFSATSGQLADKLEKGRVARFVKLLEIAIMGIAAYGWMTHHLWLLVAAVIGM
GVHSTLFGPVKYAYLPQQLRREELIGGNGLIEMGTFVGILLGEILGAVLVVHKPWGLHLV
AGMTIGIAVLGWLASLRIPLSPAPVPELKVNWNPFTETVRNLAYSRRNRPVFLSLLGNSW
FWFYGAIMLAQFPVYAKNYLHGDHSVFVLLLAVFSVGIGAGSLLCERLSGHKVEIGLVPF
GSIGLSVFGLELYFASQAYVTPTAMLDLGGFLAQGGSWRILIDCLGIGVFGGLYIVPLFA
LIQTRCDPAHVSRTIAGMNIMNALFMVVSALVAMVLLKAGLSIPQIFLATAIMNGVVAAY
IFSLVPEFLIRFLAWILIHTFYRVRIINGQAIPEQGPAVLVCNHVSYVDAIAIMAASPRP
VRFVMDHQIFRIPVMSWLFRNVRAIPIAPVKEDPWLTEKAFVDIAQALHEGELVCIFPEG
KLTRDGELNPFKGGVQKIIARSPVPVLPMALRGLWGSLFSRDPSNPVARTFKRGLFSRLE
LAVGEAIPPEQVSPELLQEKVRELRGQWK