Protein Info for HSERO_RS16500 in Herbaspirillum seropedicae SmR1

Annotation: 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00180: Iso_dh
  • amino acids 2 to 351 (350 residues), 453.2 bits, E=3.5e-140
• TIGR00169: 3-isopropylmalate dehydrogenase
  • amino acids 2 to 350 (349 residues), 485.7 bits, E=3.9e-150

Best Hits

Swiss-Prot: 91% identical to LEU3_CUPNJ: 3-isopropylmalate dehydrogenase (leuB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 100% identity to hse:Hsero_3297)

MetaCyc: 56% identical to beta-isopropylmalate dehydrogenase subunit (Leptospira interrogans serovar Lai str. 56601)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]; 1.1.1.- [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• L-leucine biosynthesis (6/6 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
• aliphatic glucosinolate biosynthesis, side chain elongation cycle (10/30 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

See D8J1Z5 at UniProt or InterPro

Protein Sequence (356 amino acids)

>HSERO_RS16500 3-isopropylmalate dehydrogenase (Herbaspirillum seropedicae SmR1)
MKIAILPGDGIGPEIVNEAVRVLNALDEKFEMETAPVGGAGYEAHGHPLPDGTLKLAKEA
DAILFGAVGDWKYDKLERALRPEQAILGLRKHLQLFANFRPAICYPELTGASSLKPELVA
NLDILIVRELNGDIYFGQPRGMREAPDGPFKGAREGFDTMRYSEPEIRRIAHVAFQAAAK
RGKRLCSVDKANVLETFQFWKDIVTEVGKEYPDVELSHMYVDNAAMQLVKAPKNFDVIVT
GNMFGDILSDAAAMLTGSIGMLPSASLDANNKGLYEPSHGSAPDIAGRGIANPLATILSA
AMMLRFSLNKAEQADRIENAVKKVLAQGLRTADIYEEGCTKVNTQQMGEAVVKALA