Protein Info for HSERO_RS16360 in Herbaspirillum seropedicae SmR1

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 894 transmembrane" amino acids 645 to 666 (22 residues), see Phobius details TIGR01070: DNA mismatch repair protein MutS" amino acids 8 to 888 (881 residues), 1053.7 bits, see alignment E=0 PF01624: MutS_I" amino acids 9 to 120 (112 residues), 146 bits, see alignment E=1.3e-46 PF05188: MutS_II" amino acids 140 to 264 (125 residues), 67.6 bits, see alignment E=3.7e-22 PF05192: MutS_III" amino acids 281 to 578 (298 residues), 150 bits, see alignment E=2.8e-47 PF05190: MutS_IV" amino acids 447 to 538 (92 residues), 110.8 bits, see alignment E=8.3e-36 PF00488: MutS_V" amino acids 628 to 815 (188 residues), 281.5 bits, see alignment E=9.5e-88

Best Hits

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to hse:Hsero_3270)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1W8 at UniProt or InterPro

Protein Sequence (894 amino acids)

>HSERO_RS16360 DNA mismatch repair protein MutS (Herbaspirillum seropedicae SmR1)
MTKDLAAHTPMMQQYLRIKADHPNTLVFYRMGDFYELFFEDAEKASRLMGVTLTQRGSSN
GTPIKMAGVPFHSVEQYLARLIKLGESVAICEQIGDPATSKGPVERKVVRVVTPGTLTDS
DLLPEKAERCLLAMQLVPSKSRKQMQVGLSWLSMASGALKMMEFTVEAALLDGRVKQELE
RISAAEVLVADGQLEWCEPLLPNRAVTVPDWHFDQPSSEKALLDQLGVATLHGFGADGLG
PAICAAGALLRYAQSTQGRGLQHVRTLTVESENEFIGLDAATRRNLELTETIRSQDANAL
APTLFSTLDHCRTAMGSRLLRHWLHHALRDQQVARARHAAINALMRTDACSGLSATLAAV
PDIERITTRIALLSARPRDLAGLRAGLQQLGSLRAYVEMCGRDADASLLTQLHEDLATPV
ECLDLLERAIMLEPAAMVRDGGVIARGFDAELDELRGLSENAGQYLLDLEARERERTGIA
NLRVEYNKVHGFYIEVTHGQTDKVPEDYRRRQTLKNAERYIIPELKAFEDKALSAQERSL
SREKFLYEQLLGDMGAHIVRLQAIAHALAQLDTLVALADHAVRNNWCAPQLVDEPCIQIE
QGRHPVVENQIERFIANDCQLAAERRLLLITGPNMGGKSIFMRQVALITLLAYVGSFVPA
TSAVIGPVDRIFTRIGAADDLAGGRSTFMVEMTESAAILNNATEHSLVLMDEVGRGTSTF
DGLALAWAIAKHLIDVTRSFTLFATHYFELTQLPEIHPTAANVHLSAVEHKDSIVFLHAV
QSGPASQSYGLQVAQLAGVPAQVIRAARKHLSALESQSMQATPQFDLFSAPAFATPGTQD
EPDPADERSESDAVEPDPLAQALLQTLAQIDPDALTPRQALEALYQLKALQAPQ