Protein Info for HSERO_RS16190 in Herbaspirillum seropedicae SmR1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details PF06532: NrsF" amino acids 11 to 213 (203 residues), 236.3 bits, see alignment E=1.5e-74

Best Hits

Swiss-Prot: 49% identical to NRSF_AZOOP: Probable anti-sigma-F factor NrsF (nrsf) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3235)

Predicted SEED Role

"EXTRACYTOPLASMIC FUNCTION ALTERNATIVE SIGMA FACTOR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1E7 at UniProt or InterPro

Protein Sequence (213 amino acids)

>HSERO_RS16190 hypothetical protein (Herbaspirillum seropedicae SmR1)
MKTDDLISMMASGVTPVDRRLPVKQMAQALLLGGLGALLLMLKIYGLRPDLGLMLGVPLF
WIKLAFPTTLAVGALLVLRRLMRPGLRVGVRWAGIALPGLAVWAGGALVLLSAPLAQRLP
LLMGISWRSCPFNIALLSIPLFIGIFWAVRGMAPTRLRLTGAIAGLLAGATATMVYCLHC
PEMGVPFWGVWYFLGILIPAAAGLLLGPRLLRW